Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clmp Rabbit Polyclonal Antibody (FITC)

Clmp Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ACAM, Asam, Ol16

UniProt

Q8K1G0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Clmp

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LWLVTYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_775177

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad7 (NM_001042660) Mouse Tagged Lenti ORF Clone
MR226590L1 10 µg

Smad7 (NM_001042660) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HSD3B1 Rabbit Polyclonal Antibody
orb330204 100 µL

HSD3B1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HYAL2 Antibody
E301235 200 µL

HYAL2 Antibody

Sign In for Pricing
View Details
Anti-Mouse CD279/PDCD1/PD1 Antibody (J43V2), PerCP
FMH02214 100 Tests

Anti-Mouse CD279/PDCD1/PD1 Antibody (J43V2), PerCP

Sign In for Pricing
View Details
TIMP1, NT (Metalloproteinase Inhibitor 1, Tissue Inhibitor Of Metalloproteinases 1, TIMP-1, Erythroid-potentiating Activity, EPA, Fibroblast Collagenase Inhibitor, Collagenase Inhibitor, TIMP, CLGI) (FITC) discontinued
T5580-08B-FITC 200 µL

TIMP1, NT (Metalloproteinase Inhibitor 1, Tissue Inhibitor Of Metalloproteinases 1, TIMP-1, Erythroid-potentiating Activity, EPA, Fibroblast Collagenase Inhibitor, Collagenase Inhibitor, TIMP, CLGI) (FITC) discontinued

Sign In for Pricing
View Details
VUP1 Antibody
orb798558 2 mg

VUP1 Antibody

Sign In for Pricing
View Details