Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zdhhc11 Rabbit Polyclonal Antibody (Biotin)

Zdhhc11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Znf399, Zdhhc20

UniProt

Q2TGJ8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TIDPADTNVRLKKDYLEPVPTFDRSKHAHVIQNQYCHLCEVTVSKKAKHC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034431

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF488A conjugate, 0.1mg/mL
BNC881707-100 1x 100 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG1707R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), CF568 conjugate, 0.1mg/mL
BNC683085-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C20orf30 (TMEM230) (NM_001009925) Human Recombinant Protein
TP324414L 1 mg

C20orf30 (TMEM230) (NM_001009925) Human Recombinant Protein

Sign In for Pricing
View Details
Nogo A (RTN4) (NM_020532) Human Over-expression Lysate
LY429630 100 µg

Nogo A (RTN4) (NM_020532) Human Over-expression Lysate

Sign In for Pricing
View Details
IDO1 Human Gene Knockout Kit (CRISPR)
KN206592 1 Kit

IDO1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Freeze Dryer BFFT-310-A
BFFT-310-A 1 Unit

Freeze Dryer BFFT-310-A

Sign In for Pricing
View Details