Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREML2 Rabbit Polyclonal Antibody (FITC)

TREML2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TLT2, TLT-2, C6orf76, dJ238O23.1

UniProt

Q5T2D2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TREML2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GRYWCMRNTSGILYPLMGFQLDVSPAPQTERNIPFTHLDNILKSGTVTTG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dnmt3a Rabbit Polyclonal Antibody (BF680)
orb1583112 100 µL

Dnmt3a Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
SARS-COV-2 Spike Protein S1 Rabbit Polyclonal Antibody
MBS9516867-01 0.05 mL

SARS-COV-2 Spike Protein S1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-COV-2 Spike Protein S1 Rabbit Polyclonal Antibody
MBS9516867-02 0.1 mL

SARS-COV-2 Spike Protein S1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-COV-2 Spike Protein S1 Rabbit Polyclonal Antibody
MBS9516867-03 5x 0.1 mL

SARS-COV-2 Spike Protein S1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit
E-UNEL-H0047-01 5x 96 Tests

Uncoated Human cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit
E-UNEL-H0047-02 15x 96 Tests

Uncoated Human cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit

Sign In for Pricing
View Details