Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREML2 Rabbit Polyclonal Antibody (HRP)

TREML2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TLT2, TLT-2, C6orf76, dJ238O23.1

UniProt

Q5T2D2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TREML2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GRYWCMRNTSGILYPLMGFQLDVSPAPQTERNIPFTHLDNILKSGTVTTG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RPS24 antibody
STJ111540 100 µl

Anti-RPS24 antibody

Sign In for Pricing
View Details
Human CCL7/MCP-3 Antibody , PE
E55A10604 50 Tests

Human CCL7/MCP-3 Antibody , PE

Sign In for Pricing
View Details
Human Interleukin 22, IL-22 ELISA kit
YLA0682HU-01 48 Tests

Human Interleukin 22, IL-22 ELISA kit

Sign In for Pricing
View Details
Human Interleukin 22, IL-22 ELISA kit
YLA0682HU-02 96 Tests

Human Interleukin 22, IL-22 ELISA kit

Sign In for Pricing
View Details
Human Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA Kit
MBS4502545-01 48 Tests

Human Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA Kit

Sign In for Pricing
View Details
Human Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA Kit
MBS4502545-02 96 Tests

Human Secretory Leukocyte Peptidase Inhibitor (SLPI) ELISA Kit

Sign In for Pricing
View Details