Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREML2 Rabbit Polyclonal Antibody (HRP)

TREML2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TLT2, TLT-2, C6orf76, dJ238O23.1

UniProt

Q5T2D2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TREML2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_079083

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr444 Protein Vector (Mouse) (pPM-C-HA)
33154024 500 ng

Olfr444 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
25-OH Vitamin D3, HRP Conjugated
T00102-10 10 mg

25-OH Vitamin D3, HRP Conjugated

Sign In for Pricing
View Details
NGAL Recombinant Antibody, PerCP Conjugated
bsm-61425R-PerCP-TR 20 µL

NGAL Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
KRTAP25-1, CT (KRTAP25-1, KAP25.1, Keratin-associated protein 25-1) (Biotin) discontinued
037642-Biotin 200 µL

KRTAP25-1, CT (KRTAP25-1, KAP25.1, Keratin-associated protein 25-1) (Biotin) discontinued

Sign In for Pricing
View Details
Human transcription factor SOX-2 Adenovirus (Ad-h-Sox2)
1786 200 µL

Human transcription factor SOX-2 Adenovirus (Ad-h-Sox2)

Sign In for Pricing
View Details
Phospho-ERK3 (Ser189) Colorimetric Cell-Based ELISA Kit (OKAG01788)
OKAG01788 2x 96 Well

Phospho-ERK3 (Ser189) Colorimetric Cell-Based ELISA Kit (OKAG01788)

Sign In for Pricing
View Details