Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uba5 Rabbit Polyclonal Antibody (Biotin)

Uba5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ube1dc1, AW240750, 5730525G14Rik

UniProt

Q8VE47

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLFDYDKVELANMNRLFFQPYQAGLSKVHAAEHTLRNINPDVLFEVHNYN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(4-Chlorophenyl)cyclobutane-d6 Carbonitrile
TRC-C379512-10MG 10 mg

1-(4-Chlorophenyl)cyclobutane-d6 Carbonitrile

Sign In for Pricing
View Details
HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), Biotin conjugate, 0.1mg/mL
BNCB3066-100 1x 100 µL

HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Apip Mouse Gene Knockout Kit (CRISPR)
KN501398 1 Kit

Apip Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GTSE1 (C-term) Rabbit Polyclonal Antibody
AP51981PU-N 400 µL

GTSE1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human HSFX2 activation kit by CRISPRa
GA119112 1 Kit

Human HSFX2 activation kit by CRISPRa

Sign In for Pricing
View Details
TSHZ1 Human Gene Knockout Kit (CRISPR)
KN415916 1 Kit

TSHZ1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details