Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMC7 Rabbit Polyclonal Antibody (HRP)

TMC7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

E7ERB6

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMC7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SWKRFLEKAREMTTHLELWREDIRSIEGKFGTGIQSYFSFLRFLVLLNLV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001153836

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Plasma Glutamate Carboxypeptidase/PGCP (C-6His)
CJ09-10ug 10 µg

Recombinant Mouse Plasma Glutamate Carboxypeptidase/PGCP (C-6His)

Sign In for Pricing
View Details
Lentiviral human NNT shRNA (UAS) - Lentiviral human NNT shRNA (UAS, iRFP) (25)
GTR15157682 1 Vial

Lentiviral human NNT shRNA (UAS) - Lentiviral human NNT shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Monkey Desmin (DES) ELISA kit
GTR10423299 96 Well

Monkey Desmin (DES) ELISA kit

Sign In for Pricing
View Details
PTX3, ID (PTX3, TNFAIP5, TSG14, Pentraxin-related protein PTX3, Pentaxin-related protein PTX3, Tumor necrosis factor alpha-induced protein 5, Tumor necrosis factor-inducible gene 14 protein) (Biotin) discontinued
040681-Biotin 200 µL

PTX3, ID (PTX3, TNFAIP5, TSG14, Pentraxin-related protein PTX3, Pentaxin-related protein PTX3, Tumor necrosis factor alpha-induced protein 5, Tumor necrosis factor-inducible gene 14 protein) (Biotin) discontinued

Sign In for Pricing
View Details
SLC38A3 Human qPCR Template Standard (NM_006841)
HK206824 1 Kit

SLC38A3 Human qPCR Template Standard (NM_006841)

Sign In for Pricing
View Details
Recombinant Vibrio vulnificus Uracil-DNA glycosylase (ung)
MBS1367024-01 0.02 mg (E-Coli)

Recombinant Vibrio vulnificus Uracil-DNA glycosylase (ung)

Sign In for Pricing
View Details