Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTNL8 Rabbit Polyclonal Antibody (Biotin)

BTNL8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BTN9.2

UniProt

Q6UX41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human BTNL8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035552

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARG2 (Arginase-2, Mitochondrial, Kidney-type Arginase, Non-hepatic Arginase, Type II Arginase)
139349 200 µL

ARG2 (Arginase-2, Mitochondrial, Kidney-type Arginase, Non-hepatic Arginase, Type II Arginase)

Sign In for Pricing
View Details
AFMID Knockout HAP1 Polyclonal Cells
ARG21725 1 Million

AFMID Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Inducible T-Cell Co Stimulator Ligand (ICOSLG)
MBS2047442-01 0.1 mL

FITC-Linked Polyclonal Antibody to Inducible T-Cell Co Stimulator Ligand (ICOSLG)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Inducible T-Cell Co Stimulator Ligand (ICOSLG)
MBS2047442-02 0.2 mL

FITC-Linked Polyclonal Antibody to Inducible T-Cell Co Stimulator Ligand (ICOSLG)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Inducible T-Cell Co Stimulator Ligand (ICOSLG)
MBS2047442-03 0.5 mL

FITC-Linked Polyclonal Antibody to Inducible T-Cell Co Stimulator Ligand (ICOSLG)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Inducible T-Cell Co Stimulator Ligand (ICOSLG)
MBS2047442-04 1 mL

FITC-Linked Polyclonal Antibody to Inducible T-Cell Co Stimulator Ligand (ICOSLG)

Sign In for Pricing
View Details