Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELOVL7 Rabbit Polyclonal Antibody (FITC)

ELOVL7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ23563

UniProt

A1L3X0

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS

Field of Research

Metabolism Research

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079206

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magt1 Mouse shRNA Lentiviral Particle (Locus ID 67075)
TL513761V 500 µL Each

Magt1 Mouse shRNA Lentiviral Particle (Locus ID 67075)

Sign In for Pricing
View Details
Recombinant Escherichia coli Sulfoxide reductase heme-binding subunit YedZ (yedZ), partial
MBS7069094 Inquire

Recombinant Escherichia coli Sulfoxide reductase heme-binding subunit YedZ (yedZ), partial

Sign In for Pricing
View Details
Recombinant Human Origin recognition complex subunit 1 (ORC1) (R297E, S450Y, T593Y, R846E)
CSB-BP621667HU (A4) (M)-01 20 µg

Recombinant Human Origin recognition complex subunit 1 (ORC1) (R297E, S450Y, T593Y, R846E)

Sign In for Pricing
View Details
Recombinant Human Origin recognition complex subunit 1 (ORC1) (R297E, S450Y, T593Y, R846E)
CSB-BP621667HU (A4) (M)-02 100 µg

Recombinant Human Origin recognition complex subunit 1 (ORC1) (R297E, S450Y, T593Y, R846E)

Sign In for Pricing
View Details
Recombinant Human Origin recognition complex subunit 1 (ORC1) (R297E, S450Y, T593Y, R846E)
CSB-BP621667HU (A4) (M)-03 1 mg

Recombinant Human Origin recognition complex subunit 1 (ORC1) (R297E, S450Y, T593Y, R846E)

Sign In for Pricing
View Details
Recombinant Escherichia coli Multifunctional CCA protein (cca)
MBS1109643-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Multifunctional CCA protein (cca)

Sign In for Pricing
View Details