Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRSN2 Rabbit Polyclonal Antibody (HRP)

NRSN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C20orf98, dJ1103G7.6

UniProt

Q9GZP1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NRSN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_079234

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atxn7 Antibody - N-terminal region : HRP (ARP37983_P050-HRP)
ARP37983_P050-HRP 100 µL

Atxn7 Antibody - N-terminal region : HRP (ARP37983_P050-HRP)

Sign In for Pricing
View Details
Human TCF3 knockdown cell line
ABC-KD15210 1 Vial

Human TCF3 knockdown cell line

Sign In for Pricing
View Details
Dapk2 Mouse Gene Knockout Kit (CRISPR)
KN504275 1 Kit

Dapk2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-MCM6 (Proliferation Marker) Monoclonal Antibody (Clone: MCM6/2999)
36-2747-100 100 µg

Anti-MCM6 (Proliferation Marker) Monoclonal Antibody (Clone: MCM6/2999)

Sign In for Pricing
View Details
Recombinant Acyl Coenzyme A Synthetase Medium Chain Family, Member 1 (ACSM1)
SIPD367Mu01-01 10 µg

Recombinant Acyl Coenzyme A Synthetase Medium Chain Family, Member 1 (ACSM1)

Sign In for Pricing
View Details
Recombinant Acyl Coenzyme A Synthetase Medium Chain Family, Member 1 (ACSM1)
SIPD367Mu01-02 50 µg

Recombinant Acyl Coenzyme A Synthetase Medium Chain Family, Member 1 (ACSM1)

Sign In for Pricing
View Details