Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C10orf57 Rabbit Polyclonal Antibody (HRP)

C10orf57 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C10orf57, bA369J21.6

UniProt

Q8TBM7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C10orf57

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

14kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_079401

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

beta Arrestin 1 (ARRB1) Rabbit Polyclonal Antibody
TA368755 100 µL

beta Arrestin 1 (ARRB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD44v6 (Marker of Tumor Metastasis) (2F10), CF594 conjugate, 0.1mg/mL
BNC941629-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (2F10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), 0.2mg/mL
BNUB3732-100 1x 100 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), 0.2mg/mL

Sign In for Pricing
View Details
Neuraminidase (From Arthrobacter ureafaciens)
EC-32118-1 1 U

Neuraminidase (From Arthrobacter ureafaciens)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713742 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
STOML2 Polyclonal Antibody
E-AB-40211-01 25 µL

STOML2 Polyclonal Antibody

Sign In for Pricing
View Details