Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM33 Rabbit Polyclonal Antibody (FITC)

ADAM33 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C20orf153, DJ964F7.1

UniProt

Q9BZ11

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ADAM33

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079496

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLEKHA1 (Pleckstrin Homology Domain-containing Family A Member 1, PH Domain-containing Family A Member 1, TAPP1, Tandem PH Domain-containing Protein 1, TAPP-1) (AP) discontinued
131451-AP 100 µL

PLEKHA1 (Pleckstrin Homology Domain-containing Family A Member 1, PH Domain-containing Family A Member 1, TAPP1, Tandem PH Domain-containing Protein 1, TAPP-1) (AP) discontinued

Sign In for Pricing
View Details
Human Nuclear Factor of Activated T-Cells,NFATC2 ELISA KIT
JOT-EK6695Hu-01 48 Well

Human Nuclear Factor of Activated T-Cells,NFATC2 ELISA KIT

Sign In for Pricing
View Details
Human Nuclear Factor of Activated T-Cells,NFATC2 ELISA KIT
JOT-EK6695Hu-02 96 Well

Human Nuclear Factor of Activated T-Cells,NFATC2 ELISA KIT

Sign In for Pricing
View Details
GDF15 Antibody
orb1537796 50 µg

GDF15 Antibody

Sign In for Pricing
View Details
SQSTM1 (Sequestosome 1, A170, OSIL, PDB3, ZIP3, p60, p62, p62B) (FITC)
MBS6438786-01 0.1 mL

SQSTM1 (Sequestosome 1, A170, OSIL, PDB3, ZIP3, p60, p62, p62B) (FITC)

Sign In for Pricing
View Details
SQSTM1 (Sequestosome 1, A170, OSIL, PDB3, ZIP3, p60, p62, p62B) (FITC)
MBS6438786-02 5x 0.1 mL

SQSTM1 (Sequestosome 1, A170, OSIL, PDB3, ZIP3, p60, p62, p62B) (FITC)

Sign In for Pricing
View Details