Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF3IP3 Rabbit Polyclonal Antibody (FITC)

TRAF3IP3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

T3JAM

UniProt

Q9Y228

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TRAF3IP3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KQKMVILQDLLSTLIQASDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079504

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase, Dusty Protein Kinase, Dusty PK, RIP-Homologous Kinase, Receptor-interacting Serine/Threonine-Protein Kinase 5, Sugen Kinase 496, SgK496, DSTYK, KIAA0472, RIP5, RIPK5, SGK496) (AP)
MBS6455645-01 0.1 mL

DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase, Dusty Protein Kinase, Dusty PK, RIP-Homologous Kinase, Receptor-interacting Serine/Threonine-Protein Kinase 5, Sugen Kinase 496, SgK496, DSTYK, KIAA0472, RIP5, RIPK5, SGK496) (AP)

Sign In for Pricing
View Details
DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase, Dusty Protein Kinase, Dusty PK, RIP-Homologous Kinase, Receptor-interacting Serine/Threonine-Protein Kinase 5, Sugen Kinase 496, SgK496, DSTYK, KIAA0472, RIP5, RIPK5, SGK496) (AP)
MBS6455645-02 5x 0.1 mL

DSTYK (Dual Serine/Threonine and Tyrosine Protein Kinase, Dusty Protein Kinase, Dusty PK, RIP-Homologous Kinase, Receptor-interacting Serine/Threonine-Protein Kinase 5, Sugen Kinase 496, SgK496, DSTYK, KIAA0472, RIP5, RIPK5, SGK496) (AP)

Sign In for Pricing
View Details
ZNF259/ZPR1 Rabbit Polyclonal Antibody
orb186656-01 50 μL

ZNF259/ZPR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF259/ZPR1 Rabbit Polyclonal Antibody
orb186656-02 100 µL

ZNF259/ZPR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF259/ZPR1 Rabbit Polyclonal Antibody
orb186656-03 200 µL

ZNF259/ZPR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human PMFBP1 shRNA (UAS) - Lentiviral human PMFBP1 shRNA (UAS, RFP) plasmid
GTR15326728 1 Vial

Lentiviral human PMFBP1 shRNA (UAS) - Lentiviral human PMFBP1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details