Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP4 Rabbit Polyclonal Antibody (FITC)

REEP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PP432, Yip2c, C8orf20

UniProt

Q9H6H4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human REEP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079508

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Goat F(ab')2 anti-Human IgG Fc fragment Secondary Antibody [Alkaline Phosphatase] (Pre-absorbed)
NBP1-75457 0.5 mg

Goat Polyclonal Goat F(ab')2 anti-Human IgG Fc fragment Secondary Antibody [Alkaline Phosphatase] (Pre-absorbed)

Sign In for Pricing
View Details
Kv2.1 (KCNB1) (NM_004975) Human 3' UTR Clone
SC211819 10 µg

Kv2.1 (KCNB1) (NM_004975) Human 3' UTR Clone

Sign In for Pricing
View Details
Rabbit Polyclonal RPL19 Antibody
NBP2-58048-25ul 25 µL

Rabbit Polyclonal RPL19 Antibody

Sign In for Pricing
View Details
Gm13043 (NM_001039595) Mouse Tagged Lenti ORF Clone
MR207716L3 10 µg

Gm13043 (NM_001039595) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PI14 Polyclonal Antibody, APC-Cy7 Conjugated
bs-9514R-APC-Cy7 100 µL

PI14 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
EEF1D Human Over-expression Lysate
orb1344780 100 µg

EEF1D Human Over-expression Lysate

Sign In for Pricing
View Details