Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP4 Rabbit Polyclonal Antibody (HRP)

REEP4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP432, Yip2c, C8orf20

UniProt

Q9H6H4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human REEP4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079508

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human H1F0/Histone H1 Protein (His Tag)
PKSH031355 100 µg

Recombinant Human H1F0/Histone H1 Protein (His Tag)

Sign In for Pricing
View Details
TTI1 (NM_014657) Human Over-expression Lysate
LC402361 20 µg

TTI1 (NM_014657) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS509644 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
(R,S)-N2-Nitroso-Anabasine N’-Beta-D-Glucuronide
TRC-N524265-1MG 1 mg

(R,S)-N2-Nitroso-Anabasine N’-Beta-D-Glucuronide

Sign In for Pricing
View Details
ADAM28 Mouse Monoclonal Antibody [Clone ID: OTI3F4]
CF812739 100 µg

ADAM28 Mouse Monoclonal Antibody [Clone ID: OTI3F4]

Sign In for Pricing
View Details
AMACR (NM_014324) Human Recombinant Protein
TP313437M 100 µg

AMACR (NM_014324) Human Recombinant Protein

Sign In for Pricing
View Details