Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP4 Rabbit Polyclonal Antibody (HRP)

REEP4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP432, Yip2c, C8orf20

UniProt

Q9H6H4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human REEP4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079508

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNC1 Rabbit Polyclonal Antibody
TA377699 100 µL

KCNC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-500 1x 500 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1c (CD1C/1603), CF488A conjugate, 0.1mg/mL
BNC881603-100 1x 100 µL

CD1c (CD1C/1603), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ldlr Mouse Gene Knockout Kit (CRISPR)
KN309204BN 1 Kit

Ldlr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific,  10nm
GAF-451-10 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Rabbit IgG, Fc Specific, 10nm

Sign In for Pricing
View Details
RER1 Human Gene Knockout Kit (CRISPR)
KN400545 1 Kit

RER1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details