Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIM2 Rabbit Polyclonal Antibody (FITC)

LIM2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MP17, MP19, CTRCT19

UniProt

P55344

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LIM2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_085915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC15A3 Rabbit Polyclonal Antibody (BF750)
orb1595240 100 µL

SLC15A3 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
ZNF313 (Zinc Finger Protein 313, RING Finger Protein 114, RNF114, Zinc Finger Protein 228, ZNF228, PSORS12) (PE)
MBS6399172-01 0.1 mL

ZNF313 (Zinc Finger Protein 313, RING Finger Protein 114, RNF114, Zinc Finger Protein 228, ZNF228, PSORS12) (PE)

Sign In for Pricing
View Details
ZNF313 (Zinc Finger Protein 313, RING Finger Protein 114, RNF114, Zinc Finger Protein 228, ZNF228, PSORS12) (PE)
MBS6399172-02 5x 0.1 mL

ZNF313 (Zinc Finger Protein 313, RING Finger Protein 114, RNF114, Zinc Finger Protein 228, ZNF228, PSORS12) (PE)

Sign In for Pricing
View Details
MatMc Antibody
orb854439 2 mg

MatMc Antibody

Sign In for Pricing
View Details
RNF41 (E3 Ubiquitin-protein Ligase NRDP1, RING Finger Protein 41, FLRF, NRDP1, SBBI03) (FITC)
132698-FITC 100 µL

RNF41 (E3 Ubiquitin-protein Ligase NRDP1, RING Finger Protein 41, FLRF, NRDP1, SBBI03) (FITC)

Sign In for Pricing
View Details
ADFP/PLIN2 Rabbit Polyclonal Antibody
orb381085 100 µg

ADFP/PLIN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details