Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIM2 Rabbit Polyclonal Antibody (HRP)

LIM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MP17, MP19, CTRCT19

UniProt

P55344

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human LIM2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_085915

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium-dependent neutral amino Acid Transporter B (SLC6A19) Human ELISA Kit
H1580 96 Tests

Sodium-dependent neutral amino Acid Transporter B (SLC6A19) Human ELISA Kit

Sign In for Pricing
View Details
CD79a (B lymphocyte-specific MB1 protein, B Cell antigen receptor complex-associated protein alpha chain, CD79a molecule immunoglobulin associated alpha, Ig-alpha, IGA, IgM-alpha, Immunoglobulin-associated alpha, Ly54, MB-1 membrane glycoprotein, Membrane
MBS6193740-01 0.1 mL

CD79a (B lymphocyte-specific MB1 protein, B Cell antigen receptor complex-associated protein alpha chain, CD79a molecule immunoglobulin associated alpha, Ig-alpha, IGA, IgM-alpha, Immunoglobulin-associated alpha, Ly54, MB-1 membrane glycoprotein, Membrane

Sign In for Pricing
View Details
CD79a (B lymphocyte-specific MB1 protein, B Cell antigen receptor complex-associated protein alpha chain, CD79a molecule immunoglobulin associated alpha, Ig-alpha, IGA, IgM-alpha, Immunoglobulin-associated alpha, Ly54, MB-1 membrane glycoprotein, Membrane
MBS6193740-02 5x 0.1 mL

CD79a (B lymphocyte-specific MB1 protein, B Cell antigen receptor complex-associated protein alpha chain, CD79a molecule immunoglobulin associated alpha, Ig-alpha, IGA, IgM-alpha, Immunoglobulin-associated alpha, Ly54, MB-1 membrane glycoprotein, Membrane

Sign In for Pricing
View Details
AKT1 Mouse Monoclonal Antibody
orb624603-01 50 µg

AKT1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
AKT1 Mouse Monoclonal Antibody
orb624603-02 100 µg

AKT1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Dixdc1 shRNA (UAS) - Lentiviral mouse Dixdc1 shRNA (UAS, iRFP) plasmid
GTR15223540 1 Vial

Lentiviral mouse Dixdc1 shRNA (UAS) - Lentiviral mouse Dixdc1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details