Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITFG1 Rabbit Polyclonal Antibody (Biotin)

ITFG1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TIP, CDA08, LNKN-1, 2310047C21Rik

UniProt

Q8TB96

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ITFG1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TAELFGAEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQNAPYFKP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_110417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP21, ID (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (MaxLight 650) discontinued
U4101-06B-ML650 100 µL

USP21, ID (Ubiquitin Carboxyl-terminal Hydrolase 21, Ubiquitin Thioesterase 21, Ubiquitin-specific-Processing Protease 21, Deubiquitinating Enzyme 21, PP1490, USP23) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Anti-Human CD29 Monoclonal Antibody (Alexa Fluor 488 Conjugated)
MBS2556470-01 20 Tests

Anti-Human CD29 Monoclonal Antibody (Alexa Fluor 488 Conjugated)

Sign In for Pricing
View Details
Anti-Human CD29 Monoclonal Antibody (Alexa Fluor 488 Conjugated)
MBS2556470-02 100 Tests

Anti-Human CD29 Monoclonal Antibody (Alexa Fluor 488 Conjugated)

Sign In for Pricing
View Details
Anti-Human CD29 Monoclonal Antibody (Alexa Fluor 488 Conjugated)
MBS2556470-03 2x 100 Tests

Anti-Human CD29 Monoclonal Antibody (Alexa Fluor 488 Conjugated)

Sign In for Pricing
View Details
Anti-Human CD29 Monoclonal Antibody (Alexa Fluor 488 Conjugated)
MBS2556470-04 10x 100 Tests

Anti-Human CD29 Monoclonal Antibody (Alexa Fluor 488 Conjugated)

Sign In for Pricing
View Details
IFNA7 siRNA (Human)
MBS8215058-01 15 nmol

IFNA7 siRNA (Human)

Sign In for Pricing
View Details