Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UNC93B1 Rabbit Polyclonal Antibody (Biotin)

UNC93B1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IIAE1, UNC93, UNC93B, Unc-93B1

UniProt

Q9H1C4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UNC93B1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK

Field of Research

Infectious Disease & Virology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl-HIST1H2BC (K116) Antibody
A24852-100UL 100 µL

Acetyl-HIST1H2BC (K116) Antibody

Sign In for Pricing
View Details
Chicken Sterol regulatory element-binding protein 1, SREBP1 ELISA KIT
E0164Ch-01 48 Well

Chicken Sterol regulatory element-binding protein 1, SREBP1 ELISA KIT

Sign In for Pricing
View Details
Chicken Sterol regulatory element-binding protein 1, SREBP1 ELISA KIT
E0164Ch-02 96 Well

Chicken Sterol regulatory element-binding protein 1, SREBP1 ELISA KIT

Sign In for Pricing
View Details
Chicken Sterol regulatory element-binding protein 1, SREBP1 ELISA KIT
E0164Ch-03 5x 96 Tests

Chicken Sterol regulatory element-binding protein 1, SREBP1 ELISA KIT

Sign In for Pricing
View Details
Chicken Sterol regulatory element-binding protein 1, SREBP1 ELISA KIT
E0164Ch-04 10x 96 Tests

Chicken Sterol regulatory element-binding protein 1, SREBP1 ELISA KIT

Sign In for Pricing
View Details
Ccdc72 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4822008 1.0 µg DNA

Ccdc72 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details