Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VMP1 Rabbit Polyclonal Antibody (Biotin)

VMP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EPG3, TANGO5, TMEM49

UniProt

Q96GC9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human VMP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEML

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112200

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBL, phosphorylated (Y774) (E3 Ubiquitin-Protein Ligase CBL, Casitas B-lineage lymphoma proto-Oncogene, Proto-Oncogene c-Cbl, RING Finger Protein 55, Signal transduction Protein CBL, CBL, CBL2, RNF55) discontinued
221406-01 50 µL

CBL, phosphorylated (Y774) (E3 Ubiquitin-Protein Ligase CBL, Casitas B-lineage lymphoma proto-Oncogene, Proto-Oncogene c-Cbl, RING Finger Protein 55, Signal transduction Protein CBL, CBL, CBL2, RNF55) discontinued

Sign In for Pricing
View Details
CBL, phosphorylated (Y774) (E3 Ubiquitin-Protein Ligase CBL, Casitas B-lineage lymphoma proto-Oncogene, Proto-Oncogene c-Cbl, RING Finger Protein 55, Signal transduction Protein CBL, CBL, CBL2, RNF55) discontinued
221406-02 100 µL

CBL, phosphorylated (Y774) (E3 Ubiquitin-Protein Ligase CBL, Casitas B-lineage lymphoma proto-Oncogene, Proto-Oncogene c-Cbl, RING Finger Protein 55, Signal transduction Protein CBL, CBL, CBL2, RNF55) discontinued

Sign In for Pricing
View Details
Recombinant Shigella flexneri Invasin ipaB (ipaB), partial
CSB-YP322404SZB-01 20 µg

Recombinant Shigella flexneri Invasin ipaB (ipaB), partial

Sign In for Pricing
View Details
Recombinant Shigella flexneri Invasin ipaB (ipaB), partial
CSB-YP322404SZB-02 100 µg

Recombinant Shigella flexneri Invasin ipaB (ipaB), partial

Sign In for Pricing
View Details
Recombinant Shigella flexneri Invasin ipaB (ipaB), partial
CSB-YP322404SZB-03 1 mg

Recombinant Shigella flexneri Invasin ipaB (ipaB), partial

Sign In for Pricing
View Details
Recombinant Human Reelin (RELN), partial
orb1652759-01 20 µg

Recombinant Human Reelin (RELN), partial

Sign In for Pricing
View Details