Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFXN3 Rabbit Polyclonal Antibody (FITC)

SFXN3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SFX3, SLC56A3, BA108L7.2

UniProt

Q9BWM7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SFXN3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEAS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112233

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Dysenteriae insA Protein (aa 1-90)
VAng-Lsx06938-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Dysenteriae insA Protein (aa 1-90)

Sign In for Pricing
View Details
COLQ (NM_005677) Human Tagged Lenti ORF Clone
RC210401L3 10 µg

COLQ (NM_005677) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
VEGF Receptor 1 (FLT1) Mouse Monoclonal Antibody [Clone ID: OTI11G5]
TA806786 100 µL

VEGF Receptor 1 (FLT1) Mouse Monoclonal Antibody [Clone ID: OTI11G5]

Sign In for Pricing
View Details
RGP1 Antibody, FITC conjugated
MBS1499604-01 0.05 mg

RGP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
RGP1 Antibody, FITC conjugated
MBS1499604-02 0.1 mg

RGP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
RGP1 Antibody, FITC conjugated
MBS1499604-03 5x 0.1 mg

RGP1 Antibody, FITC conjugated

Sign In for Pricing
View Details