Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFXN3 Rabbit Polyclonal Antibody (HRP)

SFXN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SFX3, SLC56A3, BA108L7.2

UniProt

Q9BWM7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SFXN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEAS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112233

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFalpha (TGFA/1119), CF594 conjugate, 0.1mg/mL
BNC941119-100 1x 100 µL

TGFalpha (TGFA/1119), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dibenzosuberyl Chloride
TRC-D417005-5G 5 g

Dibenzosuberyl Chloride

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (BE2.1), CF405S conjugate, 0.1mg/mL
BNC042321-100 1x 100 µL

Calcineurin B / PPP3R1 (BE2.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bismuth(III) Oxide
TRC-B497343-500MG 500 mg

Bismuth(III) Oxide

Sign In for Pricing
View Details
Stearyl Palmitate
TRC-S686590-25G 25 g

Stearyl Palmitate

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF647 conjugate, 0.1mg/mL
BNC470778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details