Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM16C Rabbit Polyclonal Antibody (HRP)

TMEM16C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DYT23, DYT24, TMEM16C, C11orf25, GENX-3947

UniProt

Q9BYT9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM16C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_113606

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM161B activation kit by CRISPRa
GA115861 1 Kit

Human TMEM161B activation kit by CRISPRa

Sign In for Pricing
View Details
SEC11A (NM_014300) Human Over-expression Lysate
LC402308 20 µg

SEC11A (NM_014300) Human Over-expression Lysate

Sign In for Pricing
View Details
Spaca4 Mouse Gene Knockout Kit (CRISPR)
KN516520 1 Kit

Spaca4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TentaGel® cMAP 4 branch amide
J2023-4.1G 1 g

TentaGel® cMAP 4 branch amide

Sign In for Pricing
View Details
AGT Polyclonal Antibody
E-AB-15916-01 20 µL

AGT Polyclonal Antibody

Sign In for Pricing
View Details
AGT Polyclonal Antibody
E-AB-15916-02 60 µL

AGT Polyclonal Antibody

Sign In for Pricing
View Details