Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM57B Rabbit Polyclonal Antibody (HRP)

FAM57B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAM57B, FP1188

UniProt

Q71RH2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM57B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WAYGRHAGLPLLAVPLAIPAHVNLGAALLLAPQLYWFFLICRGACRLFWP

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spsb4 (NM_145134) Mouse Tagged ORF Clone Lentiviral Particle
MR203658L3V 200 µL

Spsb4 (NM_145134) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human FGF21 / Fibroblast Growth Factor 21, Animal Free & Carrier Free
C-CYP325-500ug 500 µg

Recombinant Human FGF21 / Fibroblast Growth Factor 21, Animal Free & Carrier Free

Sign In for Pricing
View Details
Mouse Mucl2 (NM_009267) AAV Particle
MR200862A1V 250 µL

Mouse Mucl2 (NM_009267) AAV Particle

Sign In for Pricing
View Details
Lipf Mouse qPCR Primer Pair (NM_026334)
MP207560 200 Reactions

Lipf Mouse qPCR Primer Pair (NM_026334)

Sign In for Pricing
View Details
Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit
MBS741531-01 48 Well

Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit
MBS741531-02 96 Well

Sheep Tissue Factor Pathway Inhibitor 2 ELISA Kit

Sign In for Pricing
View Details