Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM166 Rabbit Polyclonal Antibody (FITC)

TMEM166 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FAM176A, TMEM166

UniProt

Q9H8M9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM166

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RLPLSHSPEHVEMALLSNILAAYSFVSENPERAALYFVSGVCIGLVLTLA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_115557

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Growth Hormone, Human (hGH, GH, GHN, GH-N, hGH-N, Growth Hormone 1, GH1, IGHD1B, Pituitary Growth Hormone, Somatotropin) (PE)
G9000-04G-PE 100 µL

Growth Hormone, Human (hGH, GH, GHN, GH-N, hGH-N, Growth Hormone 1, GH1, IGHD1B, Pituitary Growth Hormone, Somatotropin) (PE)

Sign In for Pricing
View Details
Human AKIP1 knockdown cell line
ABC-KD0471 1 Vial

Human AKIP1 knockdown cell line

Sign In for Pricing
View Details
ATXN7L2 Antibody - N-terminal region
ARP53155_P050-25UL 25 µL

ATXN7L2 Antibody - N-terminal region

Sign In for Pricing
View Details
CTDSP1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
17049124 3x 1.0µg DNA

CTDSP1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
MGRN1 (Mahogunin RING Finger Protein 1, E3 Ubiquitin-protein Ligase MGRN1, KIAA0544, RING Finger Protein 156, RNF156) (APC)
129663-APC 100 µL

MGRN1 (Mahogunin RING Finger Protein 1, E3 Ubiquitin-protein Ligase MGRN1, KIAA0544, RING Finger Protein 156, RNF156) (APC)

Sign In for Pricing
View Details
PAI1 Rabbit mAb
MBS8603198-01 0.1 mL

PAI1 Rabbit mAb

Sign In for Pricing
View Details