Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem117 Rabbit Polyclonal Antibody (HRP)

Tmem117 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1562562

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGKWFNYGIIFLVLILDLNMWKNQIFYKPHEYGQYIGPGQKIYTVKDSES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001058576

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic Anhydrase II (CA2) (NM_000067) Human Over-expression Lysate
LC424943 20 µg

Carbonic Anhydrase II (CA2) (NM_000067) Human Over-expression Lysate

Sign In for Pricing
View Details
Cpa2 Mouse Gene Knockout Kit (CRISPR)
KN503740 1 Kit

Cpa2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), 0.2mg/mL
BNUB2593-500 1x 500 µL

Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma Marker) (CCND1/2593), 0.2mg/mL

Sign In for Pricing
View Details
Ammonium Ferric Disulfate Dodecahydrate
TRC-A634113-5G 5 g

Ammonium Ferric Disulfate Dodecahydrate

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]
TA500020BM 100 µL

Cytokeratin 8 (KRT8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), 0.2mg/mL
BNUB3085-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3085), 0.2mg/mL

Sign In for Pricing
View Details