Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem117 Rabbit Polyclonal Antibody (HRP)

Tmem117 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1562562

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TGKWFNYGIIFLVLILDLNMWKNQIFYKPHEYGQYIGPGQKIYTVKDSES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001058576

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3 beta Recombinant Rabbit monoclonal Antibody
HA750131 100 µL

GSK3 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cox4i1 pSer58 Rabbit Polyclonal Antibody
AP26437PU-N 100 µL

Cox4i1 pSer58 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (MS4A1/3409), Biotin conjugate, 0.1mg/mL
BNCB3409-100 1x 100 µL

CD20 / MS4A1 (B-Cell Marker) (MS4A1/3409), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RASGRP2 Rabbit Polyclonal Antibody
TA361453 100 µL

RASGRP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EIF4E3 Antibody
8C15723-AAT 50 µg

EIF4E3 Antibody

Sign In for Pricing
View Details
Slc17a6 Mouse Monoclonal Antibody [Clone ID: N29/29]
75-067 100 µL

Slc17a6 Mouse Monoclonal Antibody [Clone ID: N29/29]

Sign In for Pricing
View Details