Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZDHHC16 Rabbit Polyclonal Antibody (HRP)

ZDHHC16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APH2, DHHC-16

UniProt

Q969W1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZDHHC16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQGRNDIATVSICKKC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115703

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp5o 3'UTR GFP Stable Cell Line
TU152335 1.0 mL

Atp5o 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PCNA (Proliferating Cell Nuclear Antigen) (MaxLight 490) discontinued
P3115-08-ML490 100 µL

PCNA (Proliferating Cell Nuclear Antigen) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Cortactin (p80,85) (MaxLight 490) discontinued
C7901-80-ML490 100 µL

Cortactin (p80,85) (MaxLight 490) discontinued

Sign In for Pricing
View Details
SAP, ID (E300) (Proactivator Polypeptide, Saposin-A, Protein A, Saposin-B-Val, Saposin-B, Sphingolipid Activator Protein 1, SAP-1, Cerebroside Sulfate Activator, CSAct, Dispersin, Sulfatide/GM1 Activator, Saposin-C, Co-beta-glucosidase, A1 Activator, Glucosylceramidase Activator, Sphingolipid Activator Protein 2, SAP-2, Saposin-D, Protein C, Component C, SAP1, GLBA, PSAP)
S5451-20 200 µL

SAP, ID (E300) (Proactivator Polypeptide, Saposin-A, Protein A, Saposin-B-Val, Saposin-B, Sphingolipid Activator Protein 1, SAP-1, Cerebroside Sulfate Activator, CSAct, Dispersin, Sulfatide/GM1 Activator, Saposin-C, Co-beta-glucosidase, A1 Activator, Glucosylceramidase Activator, Sphingolipid Activator Protein 2, SAP-2, Saposin-D, Protein C, Component C, SAP1, GLBA, PSAP)

Sign In for Pricing
View Details
Mouse Monoclonal human CD74 Antibody
orb1409280-01 100 µg

Mouse Monoclonal human CD74 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal human CD74 Antibody
orb1409280-02 50 µg

Mouse Monoclonal human CD74 Antibody

Sign In for Pricing
View Details