Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM107 Rabbit Polyclonal Antibody (Biotin)

TMEM107 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MKS13, JBTS29, GRVS638, PRO1268

UniProt

Q6UX40

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM107

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VVITLFWSRDSNIQACLPLTFTPEEYDKQDIHPLPLCRLVAALSVTLGLF

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_115730

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF647 conjugate, 0.1mg/mL
BNC470820-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI1G10]
CF810299 100 µg

CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI1G10]

Sign In for Pricing
View Details
Upifitamab Biosimilar - Research Grade
ICH5094-20mg 20 mg

Upifitamab Biosimilar - Research Grade

Sign In for Pricing
View Details
Musashi 1 Recombinant Rabbit Monoclonal Antibody [SJ201]
ET1606-51 100 µL

Musashi 1 Recombinant Rabbit Monoclonal Antibody [SJ201]

Sign In for Pricing
View Details
Recombinant Mouse Angptl4 Protein (Fc Tag)
PDMM100118-01 20 µg

Recombinant Mouse Angptl4 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse Angptl4 Protein (Fc Tag)
PDMM100118-02 100 µg

Recombinant Mouse Angptl4 Protein (Fc Tag)

Sign In for Pricing
View Details