Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEGF11 Rabbit Polyclonal Antibody (FITC)

MEGF11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZp434L121, KIAA1781

UniProt

A6BM72

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MEGF11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LMMEELNPYTKISPALGAERHSVGAVTGIMLLLFLIVVLLGLFAWHRRRQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

101kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_115821

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GHDC Human Gene Knockout Kit (CRISPR)
KN402272 1 Kit

GHDC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pleckstrin (PLEK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F10]
TA500901AM 100 µL

Pleckstrin (PLEK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F10]

Sign In for Pricing
View Details
Mouse Myl10 activation kit by CRISPRa
GA206378 1 Kit

Mouse Myl10 activation kit by CRISPRa

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Human IgA
HAF-002-1 1 mL

Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Human IgA

Sign In for Pricing
View Details
Pure Vicia villosa Lectin (Hairy Vetch) -VVA-
L-4601-5 5 mg

Pure Vicia villosa Lectin (Hairy Vetch) -VVA-

Sign In for Pricing
View Details
CTRP3 (C1QTNF3) (NM_181435) Human Recombinant Protein
TP313742L 1 mg

CTRP3 (C1QTNF3) (NM_181435) Human Recombinant Protein

Sign In for Pricing
View Details