Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

St6gal2 Rabbit Polyclonal Antibody (HRP)

St6gal2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

St6galII, mKIAA1877, C230064G14Rik

UniProt

B2RQY9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX2 (Transcription Factor) (SOX2/1792), CF647 conjugate, 0.1mg/mL
BNC471792-500 1x 500 µL

SOX2 (Transcription Factor) (SOX2/1792), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Leptin Receptor (LEPR) Rabbit Monoclonal Antibody
TA423075 100 µL

Leptin Receptor (LEPR) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
1-Amino-2-naphthol-4-sulfonic Acid
TRC-A619008-250MG 250 mg

1-Amino-2-naphthol-4-sulfonic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS713631 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Cyanine 7 bissuccinimidyl ester [equivalent to Cy7® bisNHS ester]
170-AAT 1 mg

Cyanine 7 bissuccinimidyl ester [equivalent to Cy7® bisNHS ester]

Sign In for Pricing
View Details
IRF3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D2]
TA500465AM 100 µL

IRF3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D2]

Sign In for Pricing
View Details