Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

St6gal2 Rabbit Polyclonal Antibody (HRP)

St6gal2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

St6galII, mKIAA1877, C230064G14Rik

UniProt

B2RQY9

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RGLSSCAVVMSAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_766417

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ULK3 Antibody
8C18627-AAT 50 µg

ULK3 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS805683 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
MUC2 (Mucin 2) (MLP/2970R), CF488A conjugate, 0.1mg/mL
BNC882970-100 1x 100 µL

MUC2 (Mucin 2) (MLP/2970R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FKBP9 Human Gene Knockout Kit (CRISPR)
KN422307 1 Kit

FKBP9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS634191 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Multi-Well Plates
DP2M-RD-96-NS 50 Pack/Case

Multi-Well Plates

Sign In for Pricing
View Details