Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dgat2 Rabbit Polyclonal Antibody (Biotin)

Dgat2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ARAT, DGAT-2, 0610010B06Rik

UniProt

Q9DCV3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080660

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DENND1C (NM_024898) Human Tagged ORF Clone Lentiviral Particle
RC206410L4V 200 µL

DENND1C (NM_024898) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Kif18b Mouse shRNA Plasmid (Locus ID 70218)
TR504402 1 Kit

Kif18b Mouse shRNA Plasmid (Locus ID 70218)

Sign In for Pricing
View Details
LY2801653 (Merestinib) 100mg
A12557-100 100 mg

LY2801653 (Merestinib) 100mg

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Guanylate kinase (gmk)
MBS1302800-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Guanylate kinase (gmk)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Guanylate kinase (gmk)
MBS1302800-02 0.1 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Guanylate kinase (gmk)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Guanylate kinase (gmk)
MBS1302800-03 0.02 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Guanylate kinase (gmk)

Sign In for Pricing
View Details