Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dgat2 Rabbit Polyclonal Antibody (HRP)

Dgat2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARAT, DGAT-2, 0610010B06Rik

UniProt

Q9DCV3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080660

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBLD Peptide - N-terminal region
MBS3237597-01 0.1 mg

PBLD Peptide - N-terminal region

Sign In for Pricing
View Details
PBLD Peptide - N-terminal region
MBS3237597-02 5x 0.1 mg

PBLD Peptide - N-terminal region

Sign In for Pricing
View Details
anti-human IL-2-Purified (with Antibiotics)
MBS666755-01 0.1 mg

anti-human IL-2-Purified (with Antibiotics)

Sign In for Pricing
View Details
anti-human IL-2-Purified (with Antibiotics)
MBS666755-02 5x 0.1 mg

anti-human IL-2-Purified (with Antibiotics)

Sign In for Pricing
View Details
ZNF419A (ZNF419) (NM_001098494) Human Untagged Clone
SC316381 10 µg

ZNF419A (ZNF419) (NM_001098494) Human Untagged Clone

Sign In for Pricing
View Details
HIST1H2BH Protein Vector (Rat) (pPM-C-His)
PV272861 500 ng

HIST1H2BH Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details