Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NYD-SP21 Rabbit Polyclonal Antibody (HRP)

NYD-SP21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MS4A16, NYD-SP21

UniProt

Q96JA4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NYD-SP21

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QYPEGQSKDGQVKDQQTDKEQNSKKQTQDQQTEDQPAQEKKSPKGQFQNV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_115986

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm10436 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4324406 1.0 µg DNA

Gm10436 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Interleukin-10 protein (IL10), Active Protein
RPC28952-01 Inquire

Recombinant Human Interleukin-10 protein (IL10), Active Protein

Sign In for Pricing
View Details
Recombinant Human Interleukin-10 protein (IL10), Active Protein
RPC28952-02 100 µg

Recombinant Human Interleukin-10 protein (IL10), Active Protein

Sign In for Pricing
View Details
EphB2, CT (Ephrin Type-B Receptor 2, Tyrosine-protein Kinase Receptor EPH-3, DRT, Receptor Protein-Tyrosine Kinase HEK5, ERK, EPH-like Kinase 5, EK5, Tyrosine-protein Kinase TYRO5, Renal Carcinoma Antigen NY-REN-47, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) (MaxLight 650) discontinued
E3371-02Q-ML650 100 µL

EphB2, CT (Ephrin Type-B Receptor 2, Tyrosine-protein Kinase Receptor EPH-3, DRT, Receptor Protein-Tyrosine Kinase HEK5, ERK, EPH-like Kinase 5, EK5, Tyrosine-protein Kinase TYRO5, Renal Carcinoma Antigen NY-REN-47, DRT, EPHT3, EPTH3, ERK, HEK5, TYRO5) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Anti-CDKN2A/p16INK4a Mouse mAb
GB121605-50 50 μL

Anti-CDKN2A/p16INK4a Mouse mAb

Sign In for Pricing
View Details
PSPH Peptide
orb1232984 0.1 mg

PSPH Peptide

Sign In for Pricing
View Details