Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD1 Rabbit Polyclonal Antibody (HRP)

ABHD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LABH1

UniProt

Q96SE0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ABHD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115993

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SET (2PP2A, IGAAD, TAF-I, I2PP2A, IPP2A2, PHAPII, TAF-IBETA, SET Nuclear Oncogene) discontinued
219223-01 20 µL

SET (2PP2A, IGAAD, TAF-I, I2PP2A, IPP2A2, PHAPII, TAF-IBETA, SET Nuclear Oncogene) discontinued

Sign In for Pricing
View Details
SET (2PP2A, IGAAD, TAF-I, I2PP2A, IPP2A2, PHAPII, TAF-IBETA, SET Nuclear Oncogene) discontinued
219223-02 100 µL

SET (2PP2A, IGAAD, TAF-I, I2PP2A, IPP2A2, PHAPII, TAF-IBETA, SET Nuclear Oncogene) discontinued

Sign In for Pricing
View Details
Androstenedione ELISA
AD183E 1 Each

Androstenedione ELISA

Sign In for Pricing
View Details
Rabbit Polyclonal CPSF73 Antibody [DyLight 680]
NB100-57528FR 0.1 mL

Rabbit Polyclonal CPSF73 Antibody [DyLight 680]

Sign In for Pricing
View Details
Rabbit Polyclonal ADAT3 Antibody
NBP2-84395-0.1mL 0.1 mL

Rabbit Polyclonal ADAT3 Antibody

Sign In for Pricing
View Details
Ptrh2 3'UTR Luciferase Stable Cell Line
TU117309 1.0 mL

Ptrh2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details