Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem147 Rabbit Polyclonal Antibody (Biotin)

Tmem147 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RGD1304706

UniProt

Q2TA63

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001033583

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf7 3'UTR GFP Stable Cell Line
TU052986 1.0 mL

C16orf7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Pak1ip1 shRNA (UAS) - Lentiviral mouse Pak1ip1 shRNA (UAS) plasmid
GTR15276391 1 Vial

Lentiviral mouse Pak1ip1 shRNA (UAS) - Lentiviral mouse Pak1ip1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
MELK (Maternal embryonic Leucine Zipper Kinase, hMELK, Protein Kinase Eg3, pEg3 Kinase, Protein Kinase PK38, hPK38, Tyrosine-Protein Kinase MELK, MELK, KIAA0175, Pk38, mPK38) discontinued
224154-01 50 µL

MELK (Maternal embryonic Leucine Zipper Kinase, hMELK, Protein Kinase Eg3, pEg3 Kinase, Protein Kinase PK38, hPK38, Tyrosine-Protein Kinase MELK, MELK, KIAA0175, Pk38, mPK38) discontinued

Sign In for Pricing
View Details
MELK (Maternal embryonic Leucine Zipper Kinase, hMELK, Protein Kinase Eg3, pEg3 Kinase, Protein Kinase PK38, hPK38, Tyrosine-Protein Kinase MELK, MELK, KIAA0175, Pk38, mPK38) discontinued
224154-02 100 µL

MELK (Maternal embryonic Leucine Zipper Kinase, hMELK, Protein Kinase Eg3, pEg3 Kinase, Protein Kinase PK38, hPK38, Tyrosine-Protein Kinase MELK, MELK, KIAA0175, Pk38, mPK38) discontinued

Sign In for Pricing
View Details
Rabbit anti-Factor V HC Antibody
YLD2996-01 50 µL

Rabbit anti-Factor V HC Antibody

Sign In for Pricing
View Details
Rabbit anti-Factor V HC Antibody
YLD2996-02 100 µL

Rabbit anti-Factor V HC Antibody

Sign In for Pricing
View Details