Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP30 Rabbit Polyclonal Antibody (FITC)

USP30 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ40511, MGC10702

UniProt

Q70CQ3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human USP30

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116052

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GMPPA (Mannose-1-phosphate Guanyltransferase alpha, GDP-mannose Pyrophosphorylase A, GTP-mannose-1-phosphate Guanylyltransferase alpha) (Biotin)
127399-Biotin 100 µL

GMPPA (Mannose-1-phosphate Guanyltransferase alpha, GDP-mannose Pyrophosphorylase A, GTP-mannose-1-phosphate Guanylyltransferase alpha) (Biotin)

Sign In for Pricing
View Details
SAPCD1 Rabbit Polyclonal Antibody (Biotin)
orb454345 100 µL

SAPCD1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Human RGS4 Protein, N-His
orb3061625-01 50 µg

Recombinant Human RGS4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RGS4 Protein, N-His
orb3061625-02 100 µg

Recombinant Human RGS4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RGS4 Protein, N-His
orb3061625-03 1 mg

Recombinant Human RGS4 Protein, N-His

Sign In for Pricing
View Details
RAPGEF5, CT (RAPGEF5, GFR, KIAA0277, MRGEF, Rap guanine nucleotide exchange factor 5, Guanine nucleotide exchange factor for Rap1, M-Ras-regulated Rap GEF, Related to Epac) (MaxLight 550)
MBS6340302-01 0.1 mL

RAPGEF5, CT (RAPGEF5, GFR, KIAA0277, MRGEF, Rap guanine nucleotide exchange factor 5, Guanine nucleotide exchange factor for Rap1, M-Ras-regulated Rap GEF, Related to Epac) (MaxLight 550)

Sign In for Pricing
View Details