Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP30 Rabbit Polyclonal Antibody (HRP)

USP30 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ40511, MGC10702

UniProt

Q70CQ3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human USP30

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116052

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kif2b shRNA (UAS) - Lentiviral mouse Kif2b shRNA (UAS) (25)
GTR15191633 1 Vial

Lentiviral mouse Kif2b shRNA (UAS) - Lentiviral mouse Kif2b shRNA (UAS) (25)

Sign In for Pricing
View Details
Procollagen C-Endopeptidase Enhancer (PCOLCE) Magnetic Fluorescence Assay Kit
MBS2157232-01 96 Tests

Procollagen C-Endopeptidase Enhancer (PCOLCE) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Procollagen C-Endopeptidase Enhancer (PCOLCE) Magnetic Fluorescence Assay Kit
MBS2157232-02 5x 96 Tests

Procollagen C-Endopeptidase Enhancer (PCOLCE) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Procollagen C-Endopeptidase Enhancer (PCOLCE) Magnetic Fluorescence Assay Kit
MBS2157232-03 10x 96 Tests

Procollagen C-Endopeptidase Enhancer (PCOLCE) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
STXBP5L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
45813061 1.0 µg DNA

STXBP5L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Serine protease persephone (psh)
MBS1315562-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster Serine protease persephone (psh)

Sign In for Pricing
View Details