Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPAT3 Rabbit Polyclonal Antibody (Biotin)

GPAT3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Agpat9, AGPAT 10

UniProt

Q4V8J4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CRICVRSLSGTIHYHNKQYRPQKGGICVANHTSPIDVLILATDGCYAMVG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001020841

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse HIRA-interacting protein 3, HIRIP3 ELISA Kit
MBS9319002-01 48 Well

Mouse HIRA-interacting protein 3, HIRIP3 ELISA Kit

Sign In for Pricing
View Details
Mouse HIRA-interacting protein 3, HIRIP3 ELISA Kit
MBS9319002-02 96 Well

Mouse HIRA-interacting protein 3, HIRIP3 ELISA Kit

Sign In for Pricing
View Details
Mouse HIRA-interacting protein 3, HIRIP3 ELISA Kit
MBS9319002-03 5x 96 Well

Mouse HIRA-interacting protein 3, HIRIP3 ELISA Kit

Sign In for Pricing
View Details
Mouse HIRA-interacting protein 3, HIRIP3 ELISA Kit
MBS9319002-04 10x 96 Well

Mouse HIRA-interacting protein 3, HIRIP3 ELISA Kit

Sign In for Pricing
View Details
MCRS1 Antibody, Biotin conjugated
CSB-PA013611LD01HU-01 50 µg

MCRS1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
MCRS1 Antibody, Biotin conjugated
CSB-PA013611LD01HU-02 100 µg

MCRS1 Antibody, Biotin conjugated

Sign In for Pricing
View Details