Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plxdc2 Rabbit Polyclonal Antibody (Biotin)

Plxdc2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Tem7, Tem7r, AI646728, AU022916, AV231634, 1200007L24Rik, 5430431D22Rik

UniProt

Q9DC11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HLKDSGASTDDSAAEKKGGTLHAGLIVGILILVLIIAAAILVTVYMYHHP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_080438

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Purinergic Receptor P2X, Ligand Gated Ion Channel 2 ELISA Kit
MBS7276806-01 48 Well

Guinea Pig Purinergic Receptor P2X, Ligand Gated Ion Channel 2 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Purinergic Receptor P2X, Ligand Gated Ion Channel 2 ELISA Kit
MBS7276806-02 96 Well

Guinea Pig Purinergic Receptor P2X, Ligand Gated Ion Channel 2 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Purinergic Receptor P2X, Ligand Gated Ion Channel 2 ELISA Kit
MBS7276806-03 5x 96 Well

Guinea Pig Purinergic Receptor P2X, Ligand Gated Ion Channel 2 ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Purinergic Receptor P2X, Ligand Gated Ion Channel 2 ELISA Kit
MBS7276806-04 10x 96 Well

Guinea Pig Purinergic Receptor P2X, Ligand Gated Ion Channel 2 ELISA Kit

Sign In for Pricing
View Details
Spink14 3'UTR GFP Stable Cell Line
TU271090 1.0 mL

Spink14 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MRP5 Rabbit Polyclonal Antibody
orb11078-01 50 μL

MRP5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details