Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORAI2 Rabbit Polyclonal Antibody (HRP)

ORAI2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CBCIP2, C7orf19, MEM142B, TMEM142B

UniProt

Q96SN7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ORAI2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_116220

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC389705 Human qPCR Primer Pair (NR_003920)
HP220609 200 Reactions

LOC389705 Human qPCR Primer Pair (NR_003920)

Sign In for Pricing
View Details
Rabbit anti-Aldose Reductase Antibody
DL92124A-01 50 µL

Rabbit anti-Aldose Reductase Antibody

Sign In for Pricing
View Details
Rabbit anti-Aldose Reductase Antibody
DL92124A-02 100 µL

Rabbit anti-Aldose Reductase Antibody

Sign In for Pricing
View Details
Recombinant Mouse 4-1BB / TNFRSF9 Protein (aa 24-187)
VAng-2781Lsx-100g 100 µg

Recombinant Mouse 4-1BB / TNFRSF9 Protein (aa 24-187)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 23A (MMP23A)
MBS2039504-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 23A (MMP23A)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 23A (MMP23A)
MBS2039504-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Matrix Metalloproteinase 23A (MMP23A)

Sign In for Pricing
View Details