Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibcd1 Rabbit Polyclonal Antibody (Biotin)

Fibcd1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI448887

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Fibcd1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DSDHSENNCAAFYRGAWWYRNCHTSNLNGQYLRGAHASYADGVEWSSWTG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

BAC39169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse myeloperoxidase-antineutrophil cytoplasmic antibody IgG (MPO-ANCA IgG) ELISA Kit
QY-E21038 96 Tests

Mouse myeloperoxidase-antineutrophil cytoplasmic antibody IgG (MPO-ANCA IgG) ELISA Kit

Sign In for Pricing
View Details
SPINK1 Rabbit Polyclonal Antibody (PerCP)
orb2434022 100 µL

SPINK1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Purple sea urchin RNAbind Rabbit Polyclonal Antibody
orb2569902 200 µL

Purple sea urchin RNAbind Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dystrobrevin alpha (DTNA) (NM_032975) Human Tagged ORF Clone Lentiviral Particle
RC221015L3V 200 µL

Dystrobrevin alpha (DTNA) (NM_032975) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bovine Carbohydrate Antigen 50 ELISA Kit
MBS084889-01 48 Well

Bovine Carbohydrate Antigen 50 ELISA Kit

Sign In for Pricing
View Details
Bovine Carbohydrate Antigen 50 ELISA Kit
MBS084889-02 96 Well

Bovine Carbohydrate Antigen 50 ELISA Kit

Sign In for Pricing
View Details