Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibcd1 Rabbit Polyclonal Antibody (Biotin)

Fibcd1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI448887

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Fibcd1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DSDHSENNCAAFYRGAWWYRNCHTSNLNGQYLRGAHASYADGVEWSSWTG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

BAC39169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psmd1 AAV siRNA Pooled Vector
37990164 1.0 µg

Psmd1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
ELISA Kit For Killer cell immunoglobulin-like receptor 3DL1
E9280r 96 Tests

ELISA Kit For Killer cell immunoglobulin-like receptor 3DL1

Sign In for Pricing
View Details
Lentiviral human WNT5A sgRNA gene knockout kit - Lentiviral human WNT5A sgRNA gene knockout kit (100)
GTR15391015 1 Vial

Lentiviral human WNT5A sgRNA gene knockout kit - Lentiviral human WNT5A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
N- ([1,1'-biphenyl]-2-yl) -N- (4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) -[1,1':4',1''-terphenyl]-4-amine
JH915869 1 Each

N- ([1,1'-biphenyl]-2-yl) -N- (4- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) phenyl) -[1,1':4',1''-terphenyl]-4-amine

Sign In for Pricing
View Details
FH Fumarase Monoclonal Antibody (2B11)
MBS9241480-01 0.1 mL

FH Fumarase Monoclonal Antibody (2B11)

Sign In for Pricing
View Details
FH Fumarase Monoclonal Antibody (2B11)
MBS9241480-02 5x 0.1 mL

FH Fumarase Monoclonal Antibody (2B11)

Sign In for Pricing
View Details