Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibcd1 Rabbit Polyclonal Antibody (HRP)

Fibcd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI448887

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Fibcd1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSDHSENNCAAFYRGAWWYRNCHTSNLNGQYLRGAHASYADGVEWSSWTG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

BAC39169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cytochrome C Oxidase Subunit IV Isoform 2 (COX4I2) ELISA Kit
YP-W101412-01 48 Tests

Human Cytochrome C Oxidase Subunit IV Isoform 2 (COX4I2) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome C Oxidase Subunit IV Isoform 2 (COX4I2) ELISA Kit
YP-W101412-02 96 Tests

Human Cytochrome C Oxidase Subunit IV Isoform 2 (COX4I2) ELISA Kit

Sign In for Pricing
View Details
DDO CRISPR All-in-one AAV vector set (with saCas9)(Human)
17782151 3x 1.0 µg DNA

DDO CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
MMRN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1313207 1.0 µg DNA

MMRN1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TKTL2 HDR Plasmid (m)
sc-428878-HDR 20 µg

TKTL2 HDR Plasmid (m)

Sign In for Pricing
View Details
DTD2 Lentiviral Activation Particles (m2)
sc-435881-LAC-2 200 µL

DTD2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details