Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fibcd1 Rabbit Polyclonal Antibody (HRP)

Fibcd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI448887

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Fibcd1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DSDHSENNCAAFYRGAWWYRNCHTSNLNGQYLRGAHASYADGVEWSSWTG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

BAC39169

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFEMP1 (NM_001039348) Human Tagged ORF Clone
RG216753 10 µg

EFEMP1 (NM_001039348) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Smim3 shRNA (UAS) - Lentiviral mouse Smim3 shRNA (UAS, RFP) plasmid
GTR15182797 1 Vial

Lentiviral mouse Smim3 shRNA (UAS) - Lentiviral mouse Smim3 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
MCK10 (DDR1) (NM_001202521) Human Untagged Clone
SC331465 10 µg

MCK10 (DDR1) (NM_001202521) Human Untagged Clone

Sign In for Pricing
View Details
PX 12
sc-358518 10 mg

PX 12

Sign In for Pricing
View Details
Cholesterol esterase (5 U/mg), Recombinant E. Coli (powder)
CES-01 5 MU

Cholesterol esterase (5 U/mg), Recombinant E. Coli (powder)

Sign In for Pricing
View Details
D-Leucine amide
FL49285 5 g

D-Leucine amide

Sign In for Pricing
View Details