Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABHD13 Rabbit Polyclonal Antibody (FITC)

ABHD13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BEM46L1, C13orf6, bA153I24.2

UniProt

Q7L211

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ABHD13

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_116248

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fancc Pre-designed siRNA Set B
SI104718B 1 Each

Mouse Fancc Pre-designed siRNA Set B

Sign In for Pricing
View Details
Goat anti-Human IgG Fc, F (ab) '2 fragment, Affinity purified, Unconjugated, min, cross-reactivity to bovine/mouse/rabbit serum
AS10 812 1 mg

Goat anti-Human IgG Fc, F (ab) '2 fragment, Affinity purified, Unconjugated, min, cross-reactivity to bovine/mouse/rabbit serum

Sign In for Pricing
View Details
Mouse Monoclonal IGF-I R/IGF1R Antibody (33255) [PE/Cy7]
FAB391PECY7 0.1 mL

Mouse Monoclonal IGF-I R/IGF1R Antibody (33255) [PE/Cy7]

Sign In for Pricing
View Details
Human JAK1 ELISA Kit
ELA-E9729h 96 Tests

Human JAK1 ELISA Kit

Sign In for Pricing
View Details
SOCS1 Rabbit Polyclonal Antibody (Biotin)
orb2122666 100 µL

SOCS1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CDC2 antibody - N-terminal region
MBS3224333-01 0.1 mL

CDC2 antibody - N-terminal region

Sign In for Pricing
View Details