Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sec11c Rabbit Polyclonal Antibody (HRP)

Sec11c Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sec11, Sec11l3, 1810029G24Rik

UniProt

Q9D8V7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079744

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIM/Homeobox Protein Lhx8 (LHX8) Antibody
abx030378-01 80 µL

LIM/Homeobox Protein Lhx8 (LHX8) Antibody

Sign In for Pricing
View Details
LIM/Homeobox Protein Lhx8 (LHX8) Antibody
abx030378-02 400 µL

LIM/Homeobox Protein Lhx8 (LHX8) Antibody

Sign In for Pricing
View Details
IFNA8 discontinued
537730-01 30ul

IFNA8 discontinued

Sign In for Pricing
View Details
IFNA8 discontinued
537730-02 100 µL

IFNA8 discontinued

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 4 (WAKL4), partial
MBS1478083-01 0.5 mg (E-Coli)

Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 4 (WAKL4), partial

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 4 (WAKL4), partial
MBS1478083-02 0.05 mg (Baculovirus)

Recombinant Arabidopsis thaliana Wall-associated receptor kinase-like 4 (WAKL4), partial

Sign In for Pricing
View Details