Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PERLD1 Rabbit Polyclonal Antibody (HRP)

PERLD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CAB2, PERLD1, PP1498, hCOS16, AGLA546

UniProt

Q96FM1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PERLD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_219487

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ubiquitin Conjugating Enzyme E2N
MBS144831-01 0.005 mg

Recombinant Human Ubiquitin Conjugating Enzyme E2N

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Conjugating Enzyme E2N
MBS144831-02 0.02 mg

Recombinant Human Ubiquitin Conjugating Enzyme E2N

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Conjugating Enzyme E2N
MBS144831-03 1 mg

Recombinant Human Ubiquitin Conjugating Enzyme E2N

Sign In for Pricing
View Details
Recombinant Human Ubiquitin Conjugating Enzyme E2N
MBS144831-04 5x 1 mg

Recombinant Human Ubiquitin Conjugating Enzyme E2N

Sign In for Pricing
View Details
Human TLE3 qPCR Primer Pair
QH05965S 200 Tests

Human TLE3 qPCR Primer Pair

Sign In for Pricing
View Details
GRB14 discontinued
389735 200 µL

GRB14 discontinued

Sign In for Pricing
View Details